Human Interferon alpha 2A
Invented at International Centre For Genetic Engineering And Biotechnology (ICGEB)
- Datasheet
- References (0)
- Inventor Info
Info
| Catalogue Number | 153800 |
| Amino Acid Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Cellular/Tissue Localisation | B cells, Cancer cells, NK cells, T cells |
| Source | Produced in Escherichia coli |
| Storage | -20 |
| Synonyms | Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a |
| Relevance | Interferon-alpha (IFN-α) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-α2 is the most potent IFN-α used in fundamental research and in most clinical applications. The best-known IFN-α2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-α modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C. |
| Notes |
Molecular Weight: 19.4 kDa UniProt number P01563 (Lys at position 23) |
| Research Area | Cancer, Immunology |
References
There are 0 reference entries for this reagent.
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
References: 0 entry
There is no reference for this reagent yet, feel free to use the button below to suggest one.
Add a reference
